PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Araha.1545s0017.1.p
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Camelineae; Arabidopsis
Family G2-like
Protein Properties Length: 413aa    MW: 46445.9 Da    PI: 6.8756
Description G2-like family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Araha.1545s0017.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1G2-like100.79.7e-3284137255
              G2-like   2 prlrWtpeLHerFveaveqLGGsekAtPktilelmkvkgLtlehvkSHLQkYRl 55 
                          prlrWtpeLH +F++ave+LGG+++AtPk +l+lm+vkgL+++hvkSHLQ+YR+
  Araha.1545s0017.1.p  84 PRLRWTPELHICFLQAVERLGGPDRATPKLVLQLMNVKGLSIAHVKSHLQMYRS 137
                          8****************************************************7 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.10.10.603.8E-3080138IPR009057Homeodomain-like
PROSITE profilePS5129413.11780140IPR017930Myb domain
SuperFamilySSF466895.02E-1681139IPR009057Homeodomain-like
TIGRFAMsTIGR015572.9E-2484139IPR006447Myb domain, plants
PfamPF002492.3E-985136IPR001005SANT/Myb domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 413 aa     Download sequence    Send to blast
MRSSSQNSEN SKTCLSNNFK ATTKNEEDKD EEDDEEGEED EEERSGDQSP SSNSYVEESG  60
SHHHHDQNKK NGGSVRPYNR SKTPRLRWTP ELHICFLQAV ERLGGPDRAT PKLVLQLMNV  120
KGLSIAHVKS HLQMYRSKKT DDPNQGDQRF SFEHGAGYTY NLSQLPMLQS FDQRPSSSLG  180
YGGGSWTDHR RQIYRSPWRG LTTRDNTRTR QTLFSSQPGE RFQGVSSSIL DDKNKTISFR  240
INSHEGVHEN NGVAGAVPRI HRSFLEGMKT FNKSWGQSLS SNIKSSSATI QQDHIATTLN  300
SYQWENARVS EGSENVLKRK SLLLSDDQCS KSDQDLDLSL SLKVPRTHDN LGECLLEDEE  360
KEHDDHQDSK GLSLSLSSSG LSNLGRTIRK EDQTDHKKRK ISVLASPLDL TL*
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00301DAPTransfer from AT2G40260Download
Motif logo
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAC0070200.0AC007020.5 Arabidopsis thaliana chromosome 2 clone T3G21 map g4514, complete sequence.
GenBankAF0852790.0AF085279.1 Arabidopsis thaliana ABA-regulated gene cluster, complete sequence.
GenBankCP0026850.0CP002685.1 Arabidopsis thaliana chromosome 2, complete sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_002881704.10.0hypothetical protein ARALYDRAFT_321718
TrEMBLD7LEH70.0D7LEH7_ARALL; Putative uncharacterized protein
STRINGfgenesh1_pm.C_scaffold_40017750.0(Arabidopsis lyrata)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM93592136
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G40260.10.0G2-like family protein